SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000012801 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000012801
Domain Number 1 Region: 96-151
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.00000556
Family VPS37 C-terminal domain-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000012801   Gene: ENSSHAG00000010954   Transcript: ENSSHAT00000012906
Sequence length 348
Comment pep:novel scaffold:DEVIL7.0:GL864905.1:774181:783118:-1 gene:ENSSHAG00000010954 transcript:ENSSHAT00000012906 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEELRTRTVEELEKLQDDPEEINRLVMESPEVQDLQLEREMALATNRSLAERNLEFQAPL
EISRSNLLDKYQELQKLVEKCQEQKARLEKFSSALQPGTLLDLLQVEGMKIEEESEAMAE
KFLEGEVPLDTFLESFASMRMLSHLRRVRVEKLQELVRKPRASKEPARPVVPPRPVIETT
TAVAEAPPAPPAAPALPATGPPYPLPYNPAPNLGVGPLAQGALPLSPCPVTTQPSYPYRG
PSGPAYAPAQPAGAALGRPWSPHSSPGPGAYPMARGPAPNPGYPQQAYFPAGGRPPYPTQ
APAYPSQPQMPNFPRQPRPSGPPQPPYPTGPALPYGFSTPQGPVWPGY
Download sequence
Identical sequences G3WBJ6
ENSSHAP00000012801 ENSSHAP00000012801 XP_012408206.1.9362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]