SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000014904 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000014904
Domain Number 1 Region: 56-104
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000000436
Family Retrovirus zinc finger-like domains 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000014904   Gene: ENSSHAG00000012716   Transcript: ENSSHAT00000015029
Sequence length 186
Comment pep:novel scaffold:DEVIL7.0:GL856933.1:1087279:1134422:1 gene:ENSSHAG00000012716 transcript:ENSSHAT00000015029 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QSKLYMEGFRSLKEGEPVEFTFKKSSKGLESIRVTGPGGSPCLGSERRPKGKTLQKRKPK
GDSRCYNCGGLDHHAKECSLPPQPKKCHYCQSIMHMVANCPHKTVPQQPTSFQGRHEAEP
QPSTSTFPREVGGAYGYSSPSYSQEGRSEISERSGRSPQETSSSKLSTSPEEQSRKGPSV
QKRKKT
Download sequence
Identical sequences G3WHJ9
ENSSHAP00000014904 ENSSHAP00000014904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]