SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000015256 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000015256
Domain Number 1 Region: 58-111
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.00000621
Family VPS37 C-terminal domain-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000015256   Gene: ENSSHAG00000013009   Transcript: ENSSHAT00000015383
Sequence length 318
Comment pep:novel scaffold:DEVIL7.0:GL841442.1:1146976:1149677:-1 gene:ENSSHAG00000013009 transcript:ENSSHAT00000015383 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLANNRSLAEGNLLYQPQLDTLKANLTQKYQELQVLFEAYQIKKTKLDQQSSNASLETL
LALLQTEGAKIEEDTENMAEKFLDGEIPLDSFIDDYQNKRKLAHLRRVKIEKLQEMVLKG
QRLPKAQVQLQPRVSDPTPAPMVPYPVSDASVPPSVMPRRIPPPPPPVPAGRFATPFTVA
MGSGQXXXXQEMVLKGQRLPKAQVQLQPRVSDPTPAPMVPYPVSDASVPPSVMPRRIPPP
PPPVPAGRFATPFTVAMGSGQALPYPGLQCPPLPPRVGLPSLSHNPQPGYPASFASPYPP
ALPQRPPRLPPHPGFILQ
Download sequence
Identical sequences G3WIK1
ENSSHAP00000015256 ENSSHAP00000015256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]