SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSHAP00000017958 from Sarcophilus harrisii 69_7.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSHAP00000017958
Domain Number 1 Region: 791-926,984-1050
Classification Level Classification E-value
Superfamily Hemopexin-like domain 2.88e-37
Family Hemopexin-like domain 0.00097
Further Details:      
 
Domain Number 2 Region: 67-107
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000000837
Family Somatomedin B domain 0.0013
Further Details:      
 
Domain Number 3 Region: 25-65
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000628
Family Somatomedin B domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSHAP00000017958   Gene: ENSSHAG00000015244   Transcript: ENSSHAT00000018106
Sequence length 1050
Comment pep:novel scaffold:DEVIL7.0:GL856758.1:1730170:1751647:1 gene:ENSSHAG00000015244 transcript:ENSSHAT00000018106 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEWKMLPIHLVVFCLFLIQVSSQDLPSCAGRCGEGYTRDAACNCDYNCQYYMECCPDYKK
VCTVELSCKGRCFESFARGRECDCDAACKKYGKCCPDYEDFCEEIHNPTTPPPSPKTPRP
SPEAPQTVKSTTKRSPKPPKKRTPDKVVESEEITEEHSISENQESSSSSSSSSSTVRKTK
SSKNSAANSALKKKPKAKDSKKKRNPKDKPTPAPPVVEDTGSGLDKPTVAPDTGVPTSRP
TQVTTTLKVTTAAPLAASKESKKVTSKETTTEKETSTAAKETTIVTREVTNTDKQTSTTA
KEATTSAKETLTTETMTAAKDAKPTTKDPEPTPENPKSTTKDPKPTPKDPKPTPEDPKPT
PKDSKPTPKDPKPTPEDPKPTPKNPKPTPEDPKPTPKDPKPTPADPKPTPKDPKPTPADP
KPTPKDPKPTPADPKPTPKDSKATPEDPKPTPKNPKATPEDPKPTPEEPKPTPKDPKATP
EDPKPTPEDPKPTPEEPKPIPKDPKATPEDPKPTPEDPKPTPKDPKATPEDPKPTPKDSK
PTPEDPKPTPEDLKPTPKDPKATPEDPKPTPEDPKPTPKDPKATPEDPKPTPKDSKPTPE
DPKPTHETTTAPKVTPKPKTTTTAPKVITPKPIKTTTKTKETTTKAKETTIVTKETATPL
VPTPDPKVTNKKPTAAPQKPETTSKITTTSEKTTTLKTSTVTDLNSMPLEEATPQTTPGP
NRRPNSEITTSLTIPEVTPKNEGLIFEQEKPYLNPRPPVFFPIGIPGSNMYVERRPGQDF
SNTPLLSDETNLCNGKPVDGLTTLRNGTLVAFRGHYFWLLNPFTPPSPARRITDVWGIPS
PIDTVFTRCNCEGKTFFFKDSYYWRFTNDIKDPGYPKPIAKGFGGLNGKIVAALSIAKYK
NRPESVYFFKRGGTIQQYTYQQEPVRKCSGRRSTINYSVYGEPTQIRRRRYERAIIPSQT
HTIRISYSPVRVTYQKGFLHNEVKLNTIWRGLPKMVTSAIALPNIRKPDGYDYYAFSKDR
YYNIDVPSRTANLITTRSGQTLSNVWYKCP
Download sequence
Identical sequences G3WRA3
ENSSHAP00000017958 ENSSHAP00000017958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]