SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|379019674|ref|YP_005295908.1| from Rickettsia rickettsii str. Hlp#2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379019674|ref|YP_005295908.1|
Domain Number 1 Region: 213-614
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 4.84e-90
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.00026
Further Details:      
 
Domain Number 2 Region: 75-211
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 8.79e-36
Family Ferredoxin domains from multidomain proteins 0.00021
Further Details:      
 
Domain Number 3 Region: 1-74
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.37e-20
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|379019674|ref|YP_005295908.1|
Sequence length 671
Comment NADH dehydrogenase subunit G [Rickettsia rickettsii str. Hlp#2]
Sequence
MIKLNVDGSEIEVSEGSTVYQACTQAGKEIPHFCYHERLKIAGNCRMCLVEMEKSPKPIA
SCAMPVSNGMVIHTDTPMVKKAREGVMEFLLINHPLDCPICDQGGECNLQDQAFRYGKGT
NRFHENKRSIKDKYMGPLIKTAMTRCIQCTRCIRFASDIAGIEEMGAIHRGEHIEVTSYL
EQTLDSEISGNMIDICPVGALNSKPYAFKARKWELKHTASIGVHDAEGSNIRIDSRGDEV
MRILPRVNEEINEEWLSDKNRFSYDGLKYQRLDRPYIRKNGKLVEASWSEALKTVADKIK
SVKPEKIAAIAGSLSSVESMFMLKTLLQKLGSNNYSVNQFDYKLDTMQRGNYLFNTTIAG
IEKADLCLLIGANPRQIAPVLNSRIGMRVRADSLKVARIGGGHNQTYKIQDLGSDIKIIE
GLAIGTHEFTKVLKAAKYLMIIVGDGVYARDDGYAILSLIHKIVTEYNIMRDDWKGFNIL
HNHASIVGGLDIGFNTPIKLEELELAYLLGTDAIPFNKLKSTFIIYQGHHGDAGASSADV
ILPAAAYTEQSGIYVNLEGRPQIAEKAVSPVGVAKEDIEIIKELAGYLKIDIGMDNLQEV
RVRLAKEYKVFASIDRIIENKFSKFSSKDKLSKEPITAEPINYYMTDVISKNSVTMAKCV
EAKEARDEEAA
Download sequence
Identical sequences H6PVD1
gi|379019674|ref|YP_005295908.1| gi|379712946|ref|YP_005301285.1| WP_014363296.1.16657 WP_014363296.1.76853

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]