SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|347525668|ref|YP_004832416.1| from Lactobacillus ruminis ATCC 27782

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|347525668|ref|YP_004832416.1|
Domain Number 1 Region: 4-206
Classification Level Classification E-value
Superfamily Formyltransferase 1.3e-62
Family Formyltransferase 0.00000687
Further Details:      
 
Domain Number 2 Region: 205-305
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 1.28e-19
Family Post formyltransferase domain 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|347525668|ref|YP_004832416.1|
Sequence length 315
Comment methionyl-tRNA formyltransferase [Lactobacillus ruminis ATCC 27782]
Sequence
MTSIVFMGTPKFSAPILEGLIRGGYDVKAVVTQPDRYVGRKHVLTASPVKETAVRHGIEV
LQPEKISGSAEMDRIIELKPDLIVTAAFGQFLPNKLIEAAKVAAINVHGSLLPKYRGGAP
VQYAIMNGDSETGVTIIYMVKKMDAGAMLAQAKMPIEENDDTATVFQKMSILGRDTLLET
IPKILDGTIKPIAQNEERVVFSPTIKPEEEELSLESTARELDWKIRALRPTPGAYFADFL
GKRTKLWDISVLDEKTAFASGTVVEAGKHVLKMAAADGTVYRINELQPAGKPKMKATDYL
NGIGKGLEAGQKVIV
Download sequence
Identical sequences G2SPG7
WP_014073661.1.11855 WP_014073661.1.55344 gi|347525668|ref|YP_004832416.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]