SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385840288|ref|YP_005863612.1| from Lactobacillus salivarius CECT 5713

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385840288|ref|YP_005863612.1|
Domain Number 1 Region: 3-202
Classification Level Classification E-value
Superfamily Formyltransferase 3.53e-62
Family Formyltransferase 0.00000383
Further Details:      
 
Domain Number 2 Region: 205-305
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 4.12e-22
Family Post formyltransferase domain 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|385840288|ref|YP_005863612.1|
Sequence length 318
Comment Methionyl-tRNA formyltransferase [Lactobacillus salivarius CECT 5713]
Sequence
MTNIVFMGTPAFAAPILEGIIENGYNILAVVTQPDRPVGRKRVLHASPVKEVALKYGIKV
FQPVKLSGSDEMQEIIDLQPDLIVTAAYGQFLPTKLIESAKIAAINVHGSLLPKYRGGAP
VQYSIMNGDDKTGVTIIYMVKKMDAGDMLAQAELKIESTDDTGTIFEKMSILGRDVLLET
LPKIISGNVEAVKQDENKVVFSPNIKPEEEILHLNLEAKEIDWKTRALRPAPGAYFKNFK
GKRTKLWSIKPLEEKTEFAPGYVVNVDKHELKVSAYNGTVYSIIELQPAGKQKMDITSYL
NGVGQGLKIGQRIIEDEE
Download sequence
Identical sequences A0A1V9RUG5
gi|385840288|ref|YP_005863612.1| WP_014568293.1.24464 WP_014568293.1.26735 WP_014568293.1.34351 WP_014568293.1.48238 WP_014568293.1.48449 WP_014568293.1.50761 WP_014568293.1.54215 WP_014568293.1.63042 WP_014568293.1.6417 WP_014568293.1.76636 WP_014568293.1.88204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]