SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385840331|ref|YP_005863655.1| from Lactobacillus salivarius CECT 5713

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385840331|ref|YP_005863655.1|
Domain Number 1 Region: 1-188
Classification Level Classification E-value
Superfamily Formyltransferase 1.26e-55
Family Formyltransferase 0.0000339
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|385840331|ref|YP_005863655.1|
Sequence length 195
Comment Phosphoribosylglycinamide formyltransferase [Lactobacillus salivarius CECT 5713]
Sequence
MRVAIFASGNGTNFEVLADKFAKKEITGNLVLLFCDHPNAPVIKRAEKFNIPYETFTVKE
CGNKLDYEKRIVEVLKAHQIDFIALAGYMRIIGKPILDEYEGSIINLHPAYLPEYQGLHA
IERAFADHKEHNKDQTGVTLHYIDSGLDSGPVIYQEHVPIYQDDTCETLEERIHECEHRI
YPKVLNEVLLSKSNN
Download sequence
Identical sequences A0A1V9TI06 H7FXV2
WP_003709972.1.24464 WP_003709972.1.38084 WP_003709972.1.48238 WP_003709972.1.48449 WP_003709972.1.50761 WP_003709972.1.54215 WP_003709972.1.59320 WP_003709972.1.61399 WP_003709972.1.63042 WP_003709972.1.672 WP_003709972.1.68358 WP_003709972.1.76244 WP_003709972.1.84698 gi|385840331|ref|YP_005863655.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]