SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|473832179|ref|YP_007684477.1| from Clavibacter michiganensis subsp. nebraskensis NCPPB 2581

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|473832179|ref|YP_007684477.1|
Domain Number 1 Region: 293-607
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.34e-56
Family beta-glycanases 0.0052
Further Details:      
 
Domain Number 2 Region: 16-190
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.94e-46
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.0032
Further Details:      
 
Domain Number 3 Region: 194-295
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 0.000000000271
Family beta-Galactosidase/glucuronidase domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|473832179|ref|YP_007684477.1|
Sequence length 620
Comment putative glycosyl hydrolase, family 2 [Clavibacter michiganensis subsp. nebraskensis NCPPB 2581]
Sequence
MSDSTATAAGSTATAIPKPEHPRPQSTRPDWLNLNGPWQFERDRGDSGLERGLLVRDLAE
EILVPFAPESSASGIGDVDFLTAVWYRRTVRIPAGWSGRRVLLHFGAVDHDATVWVGGEE
VARHRGGFTSFTADLGVRADEEELTIVVRARDTRDEPQARGKQATWFENTSCFYTRTTGI
WQTVWLEPVPEAHIRSAHIEPQRADSSFTVTPELSHRTAGLAFEAVLADAAGEITRAQIP
AGDMGARVTLRIPADRVRVWSPEDPHLYDIALRLVDASGDVDHVVDEVASYGGLRSIAID
GRDVLLNGRRVFQRLVLDQGYWPDTLMTSPDDAALVRDIELSMAAGFNGARLHQKVFEKR
FLFHADRLGYLVWGEFGDWGAGGGLGKDAQQPTASFITQWIEAVKRDRSHPSIVGWCPLN
ETYQAIHDRITQLDDVTAGMYLATKAADPSRPVLDASGYSHRVRSSDVYDSHSYEQDPDA
FRREQAGLADGRPFVNELQGRAISVPYAGQPFFLSEYGGIWWNPDEIDRPQDASDDPARA
VSWGYGERVASVEEWHARFRGLTEVLLEDPLMFGYCFTQLTDTFQEQNGIYDFHRRPKFD
IARIREVQEQRAAYEARDDA
Download sequence
Identical sequences M5B602
WP_015488932.1.38469 WP_015488932.1.57954 WP_015488932.1.98982 gi|473832179|ref|YP_007684477.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]