SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|473832594|ref|YP_007684892.1| from Clavibacter michiganensis subsp. nebraskensis NCPPB 2581

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|473832594|ref|YP_007684892.1|
Domain Number 1 Region: 54-169
Classification Level Classification E-value
Superfamily E set domains 1.19e-17
Family Copper resistance protein C (CopC, PcoC) 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|473832594|ref|YP_007684892.1|
Sequence length 278
Comment copper resistance protein [Clavibacter michiganensis subsp. nebraskensis NCPPB 2581]
Sequence
MTPGGRIPARGGAGRRPLRTLAAAVAGAALATGAFALAGLAQGSGPDGALSASAHDYLVS
SSPAAGSTIDAPPSEVTLTFNDVILDLGTPGGAGGDASTGSGTGAGGSSIVQVTGPDAQG
MHFETGCATNSGRTVSVPVALGGSGQYTVTWRVVSADGHPVSDSIAFMYQAPAGVTASSG
TADGPGCAAAQEGAAGSGAAASGGSGGAGSSTDAGTAAGQEQGVTPYLGVIVGVSIGIVV
LAAAAVVLIVVTGRRKPAASAAAPVMGDAPPEGGPPAA
Download sequence
Identical sequences M5B6R7
WP_015489342.1.38469 WP_015489342.1.57954 WP_015489342.1.98982 gi|473832594|ref|YP_007684892.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]