SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|473833003|ref|YP_007685301.1| from Clavibacter michiganensis subsp. nebraskensis NCPPB 2581

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|473833003|ref|YP_007685301.1|
Domain Number 1 Region: 14-300
Classification Level Classification E-value
Superfamily (Trans)glycosidases 5.69e-78
Family NagZ-like 0.00017
Further Details:      
 
Domain Number 2 Region: 324-393,558-712
Classification Level Classification E-value
Superfamily Beta-D-glucan exohydrolase, C-terminal domain 5.36e-56
Family Beta-D-glucan exohydrolase, C-terminal domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|473833003|ref|YP_007685301.1|
Sequence length 824
Comment beta-glycosidase, glycosyl hydrolase family 3 [Clavibacter michiganensis subsp. nebraskensis NCPPB 2581]
Sequence
MDPHDTPTPLDPDVTALEELASRLTLEQKVQLITGRDFWTTWPVEGIGLRRMLVSDGPSG
VRGEVWDERSPSLNLPSASALSSSWDTGIAARYGRASAVEARRKGVDVVLGPTINLHRSP
YGGRHFEAFSEDPLLTADLAAAYVAGVQENGVGATPKHYVANEYESDRFTADSVVSERAL
RELYLAAFEKAVVESRAWLVMSSYNSINGTTSTENDLLETPLNSEWGFDGVVVSDWTGVR
SVDAARASQDLEMPGPVGAWGDVLLDAVRDGRVPESDIDRKVIRLLRLAARVGALEGFDA
VAPAPVAVEDGVAFARTGAAAGTVLVRNAGGILPLDASALRSVAVIGHNAVEARTQGGGS
ATVIPEHVVTPLDGIRDALGDGVDVRYARGAVVQKGIQELPLAEIRNPRTGEPGALVRFL
DADGGEMFTEDRRATTLMYFGGDAPTGTAAVIGITTRWTPATTGEVLAGFSATGRGRVCA
DGALLREDGAAPAGMDLGASLLSPPSISAPLQATTGQPVDLRVEFELTSAPGGLAGILGI
TMGIEADESAPERLLDEAVEAATGADVAIVVVGTNAQVESEGFDRDSLALPGRQDELVRR
VAAANPRTIVVVNSGSPVLLPWRDDVQALVLAWFGGQEFGGALADVLFGDVEPGGRLPTT
WPATEEDVPVRSVTPVDGRVVYDEGIHVGYRAWLRSGATPAYPFGHGLGYTTHAIDDLRV
AEDGAGGITATVTVTNTGDRAGKQVVQAYLSRAGSAVDRPVRWLAGFAAVQLEAGASAEV
DVAIGARSFAHWDGGWQREPGAFRLHVGTSVVATPLEAEVDPAA
Download sequence
Identical sequences M5BD10
WP_015489743.1.38469 WP_015489743.1.57954 WP_015489743.1.98982 gi|473833003|ref|YP_007685301.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]