SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|473833359|ref|YP_007685657.1| from Clavibacter michiganensis subsp. nebraskensis NCPPB 2581

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|473833359|ref|YP_007685657.1|
Domain Number 1 Region: 118-457,486-561
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.04e-112
Family Amylase, catalytic domain 0.000000435
Further Details:      
 
Domain Number 2 Region: 1-94
Classification Level Classification E-value
Superfamily E set domains 4.2e-19
Family E-set domains of sugar-utilizing enzymes 0.0099
Further Details:      
 
Domain Number 3 Region: 578-675
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.000000000446
Family alpha-Amylases, C-terminal beta-sheet domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|473833359|ref|YP_007685657.1|
Sequence length 678
Comment glycosidase, glycosyl hydrolase family 13 [Clavibacter michiganensis subsp. nebraskensis NCPPB 2581]
Sequence
MPLGLTLHDQGGTLRVVSHGASAVELTVSDVDDPRRVVEVVAMERGDAGVWTGSSARLVP
GTAYSVRVDGDPAPGDSFDPTRHLLDPYARGLVQVGPAAWRSVATREVPAEERAARRAAR
PVVPRDRQVVYELHVRGFTKTDERLPEELRGTYAGLGHPTTVERLVDLGITTVELLPVHA
STSEERLRAQGRINHWGYNTLAYLAPHAPYATRRARDAGADEVAAEFRGMVDALHAAGIQ
VVLDVVYNHTAEEGADGPVTSLRGIDGSRYYRHTPDGTPIDVTGCGNTVDLSRPDAQRLV
LDSLEHWSDVMGVDGFRFDLAVTLGRDERVDFDPAHPLLRAIVEDEALQGLLMIAEPWDV
GMGGWRTGGFGSGWSEWNDGYRDVVRDFWLTDVAESRRTGRAPNGVGALASCLAGSSGTF
AADRGPLASVSFVTAHDGFTLADLTSYDRKHNSGNGESNRDGTDANRSWNHGVEGPTRDA
AILAARRRTSRNLLGTLLVSAGIPMITMGDERGRTQRGNNNGYCLDNAATWMRWDEDAWR
MDLEATTRHLLRIRRENPALRPVRYAEPDAHVPSASVLAWRDADGTPMTEAAWESTGTRT
LQWITTSTPETEEPSRVLVVIHGQESRATVTLPEHDGVACWRLLWSSEWERPEVVATDDA
PGDRVEVDGPALGIYQAR
Download sequence
Identical sequences M5B8G6
gi|473833359|ref|YP_007685657.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]