SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|473833390|ref|YP_007685688.1| from Clavibacter michiganensis subsp. nebraskensis NCPPB 2581

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|473833390|ref|YP_007685688.1|
Domain Number 1 Region: 82-516
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.77e-101
Family Amylase, catalytic domain 0.0000000197
Further Details:      
 
Domain Number 2 Region: 5-84
Classification Level Classification E-value
Superfamily E set domains 0.000000000123
Family E-set domains of sugar-utilizing enzymes 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|473833390|ref|YP_007685688.1|
Sequence length 600
Comment maltooligosyl trehalose trehalohydrolase [Clavibacter michiganensis subsp. nebraskensis NCPPB 2581]
Sequence
MTDDRFDIWAPKAHTLALSVGDERLPLSPVGDGWWTLDADRAEALPSGDLDYGYLVDDAD
TPLPDPRSRRQPEGVHGRSRTYDPSSFAWTDQAWSGRQFAGAVIYEMHIGTFTPDGTLDS
AIDRLDHLVALGVDLVEVLPVNGFNGTHNWGYDGVLWYTVQETYGGPEAYQRFVDACHAR
GLGVVQDVVYNHLGPSGNYLPEFGPYLHEASANTWGSSLNLDGEDSGPVREYIIDNALMW
LGDYHVDALRLDAVHALVDDTATHLLEELAVQVDVLSAHVGRPLTLIAESDLNDPKLITS
REAHGYGLDAQWSDDFHHAVHVALTGETTGYYEDFASLGALAKVITRGFFHDGTWSSFRG
RVHGRPIDTERIPAHRLVVANQNHDQIGNRATGDRLSATLDEGGLALAAVLTLTSPFTPM
LFMGEEWGATTPWQFFTSHPEHDLGEATAKGRIAEFAKMGWDESVVPNPQDLSTFQDSKL
DWSELYGAEAADSQHARLFALYGQLIRLRRAHPDLTDPRFAEVEVEVHEEARLLVMDRGE
LSIVVNLSDEERRVPVVGERPALLLATVPGVALGDDEVVLPARSAAILGPVADSAEALLV
Download sequence
Identical sequences M5B8L7
WP_015490117.1.38469 WP_015490117.1.57954 WP_015490117.1.98982 gi|473833390|ref|YP_007685688.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]