SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|473833391|ref|YP_007685689.1| from Clavibacter michiganensis subsp. nebraskensis NCPPB 2581

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|473833391|ref|YP_007685689.1|
Domain Number 1 Region: 4-381,416-689
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.17e-129
Family Amylase, catalytic domain 0.0000000726
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|473833391|ref|YP_007685689.1|
Sequence length 783
Comment maltooligosyltrehalose synthase [Clavibacter michiganensis subsp. nebraskensis NCPPB 2581]
Sequence
MRTPISTYRFQVRESFDLAAVAEQLPYVKDLGADWVYLSPILAAEPGSDHGYDVVDHAQV
DPARGGAAGMEAVADRAHELGLGVLVDIVPNHVAVATPVESLWWWDLLTHGTASRYADAF
DVDWDFGQGKVRIPVLGDGESELDELKLVRGDDGTVELRYYDTRYPVAPGTAEDDADART
VHERQSYELINWRRADAELNYRRFFAVNTLAGIRVELPRVFEESHAEISRWFREGLADGL
RVDHPDGLLDPKGYLDDLARITGGAYVLVEKILEPGETLPTDWATAGTTGYDALAEIDRV
LVDPDGQVELDHLEASLRGLPQGELTSWADMIRGTKRAIADGILRSEVLRLERLVEDAPA
DAADAFAELLATFPVYRSYLPGGIHHLEEASAAARISRPDLVATIDALMPQLSDPSTAVA
QRFQQTSGMVMAKGVEDTAFYRYSRLVSLNEVGADPSIFAIDVDDFHARQQERHRLAPHA
MTTLSTHDTKRGEDVRARIDVLSETPEAWRDALGQLREVAPTGDGPFENLLWQTLVGTWP
ASRERLHAYAEKASREAGDITTWTAPDEAFEERMHALVDAAFDDPRARTIVAGLYDRLSG
PGWSNSLAAKAIQLTAPGMPDVYQGSELWETSLVDPDNRREVDFGTRRAALDAVLKGAEP
AIDETGAAKLLVTARALRLRREHPELFTGYEPVRATGDAAAHVIAFDRGGAITVATRLPV
GLETGGGWGSTSIALPEGELVDHVSGRRLDGGRVSVAALLADYPVAILAPASTAADLTPG
SRA
Download sequence
Identical sequences M5BA88
WP_015490118.1.38469 WP_015490118.1.57954 WP_015490118.1.98982 gi|473833391|ref|YP_007685689.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]