SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|473833631|ref|YP_007685929.1| from Clavibacter michiganensis subsp. nebraskensis NCPPB 2581

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|473833631|ref|YP_007685929.1|
Domain Number 1 Region: 232-573
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.67e-81
Family beta-glycanases 0.00000409
Further Details:      
 
Domain Number 2 Region: 67-208
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.21e-32
Family CBM22 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|473833631|ref|YP_007685929.1|
Sequence length 665
Comment endo-1,4-beta-xylanase [Clavibacter michiganensis subsp. nebraskensis NCPPB 2581]
Sequence
MSIPRTDTSALADVSPPRLGRSRFAPRPRRDRRRGLAALTALGLIAGAGALTAPAAQAAD
AAAPAGIGSDFESGTGAWAPRGDGVRIAPSTEARTGSGSLLVTDRTQEWHGAALDVTGAL
TVGQQVEVTVWARLAAGEEPASLKVSVQRDTGGGSGYDGVAGAAARVTADAWTELTGTYT
LGGPVDKAQVYVEGTVGADFLLDDFQLGEAVSTPVQTDIPALQDVLGARGIEHVGVAIDG
RETVGAGADLVGRQFNAFTPENAGKPESVQPEEGRFTFAQIDQLLDYADRTGTKVYYHVL
FWHSQTPAWFFLDGDRPLTDSPADQALLRARMEAHVKGIADHVAARYPDGGSPIWAMDVV
NEVIDDGPNDNAHDMRDSRWYQVLGEGFVDEGFRLARAYFPGVKLFINDYNTELPTKRAD
YLELISALVARGVPIDGVGHQAHVDFARPVSWLRDSIRAVERIDTRLLQAITELDVNASN
QNEGADVSGAPQDPYTPVYADDADAGAEVGHYYRDLFQMIRQQAASIDSVTFWGVSNARS
WLRTWPIARPWEQPLPFDDDLQAAPAYWGIVDAKRLPARPADLSAPRIADVDDITAVATK
AAGVRVPYALPSAIDTRDGNVRVLCAPPRSGIFPVGTTTVTCTAKDRAGNVRTSEFDVIV
TRAGS
Download sequence
Identical sequences M5BAQ3
WP_015490349.1.38469 WP_015490349.1.57954 WP_015490349.1.98982 gi|473833631|ref|YP_007685929.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]