SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|473833669|ref|YP_007685967.1| from Clavibacter michiganensis subsp. nebraskensis NCPPB 2581

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|473833669|ref|YP_007685967.1|
Domain Number 1 Region: 17-337,364-471
Classification Level Classification E-value
Superfamily (Trans)glycosidases 8.59e-126
Family Amylase, catalytic domain 0.000000447
Further Details:      
 
Domain Number 2 Region: 477-563
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.00000000128
Family alpha-Amylases, C-terminal beta-sheet domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|473833669|ref|YP_007685967.1|
Sequence length 573
Comment putative trehalose synthase [Clavibacter michiganensis subsp. nebraskensis NCPPB 2581]
Sequence
MSFTAPITLPGLTLDKQWYKRSVFYEVMIRSFVDSNGDGTGDIQGLISKLDYLQWLGIDG
LWLPPFFQSPLRDGGYDISDYMAVLPEFGTLDDFKELVTKSHERNMRIVIDLVMNHTSDQ
HEWFQQSRSDPDGPYGDFYVWSDTDEKYEDIRVIFVDTEESNWTFDPVRRQFFFHRFFSH
QPDLNFDNPKVHEAIYGVIRHWLDMGVDGLRLDAIPYLYETEEGNGEGEPATHEFLKRLR
AMVDEEYPGRILIAEANQWPREVSAFLGTEEEPECHMAFDFPIMPRIFYSLRSQTADELK
RIMGETFEIPEAAAWGVFLRNHDELTLEMVSEEYRQAMYGWYAYDPRMRVNIGIRRRLAP
LLDNSRAELELVHALLFSLPGSPFLYYGDEIGMGDNIWLPDRDASRTPMQWTPDRNAGFS
TADPGKLYLPVVQSLVYNYAQINVESQLAQSRSLLHWVRNVIHVRKAHPVFGQGTIRVLP
TDHESVLAFVRSYEGSGTHFGDRAEDVLCVFSFAHNPVSVTIDASDFAGSQLYDLFGGGV
FPTVGDDGRLTLTLATQSFYWLHMGAPAIGGRP
Download sequence
Identical sequences A0A251Y2M6 M5B974
WP_015490386.1.38469 WP_015490386.1.57954 WP_015490386.1.71501 WP_015490386.1.98982 gi|473833669|ref|YP_007685967.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]