SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|473834336|ref|YP_007686634.1| from Clavibacter michiganensis subsp. nebraskensis NCPPB 2581

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|473834336|ref|YP_007686634.1|
Domain Number 1 Region: 18-387
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.78e-104
Family beta-glycanases 0.000000000969
Further Details:      
 
Domain Number 2 Region: 370-509
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 4.68e-28
Family Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|473834336|ref|YP_007686634.1|
Sequence length 514
Comment alpha-N-arabinofuranosidase [Clavibacter michiganensis subsp. nebraskensis NCPPB 2581]
Sequence
MTRARITIDRDFTIGDVPRRLFGSFVEHMGRCVYSGIYEPGHPTATPEGYRQDVLDLTKE
LGATVVRYPGGGGNFVSGYDWEDGVGPVADRPRRLDGAWHTVETNAFGLHEFVGWSKAAG
VEVMEAVNLGTRGVDAARSLVEYANHPGGSKHSDMRRRNGAEEPFDIKLWCLGNEMDGPW
QIGHKTADEYGRLAQEAGKAMRLVDPSIELVAFGSSNSGMPTFGQWEQTVLGHTYDVVDY
VSLHAYDQEHDGDVRSFLASAVDMDFFIESVVATADATGARLKNRKRIDLSFDEWNVWYQ
RGLDGEDQPHRIEKAGWREHPRVIEDEYSVTDAVVVGTLLNSLLRHGDRVKIANQAQLVN
VIAPIRSEEGGPAWRQSIFWPFARMAQLATGRILQVEVDSDRYDNDRFGTADVVDVSATW
DDEAGTVALFLANRGLEEEASAEVALRGLDAGRIRRAEVLRVPEGGDRHSSNTVETGEQV
GLVPLEGVHAEGGRLTLTLPALSWAVVVLDVTRS
Download sequence
Identical sequences M5BC37
gi|473834336|ref|YP_007686634.1| WP_015491033.1.38469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]