SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|473834344|ref|YP_007686642.1| from Clavibacter michiganensis subsp. nebraskensis NCPPB 2581

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|473834344|ref|YP_007686642.1|
Domain Number 1 Region: 44-386
Classification Level Classification E-value
Superfamily (Trans)glycosidases 5.56e-80
Family beta-glycanases 0.0000000127
Further Details:      
 
Domain Number 2 Region: 443-539
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 2.51e-19
Family Cellulose-binding domain family II 0.0018
Further Details:      
 
Weak hits

Sequence:  gi|473834344|ref|YP_007686642.1|
Domain Number - Region: 392-457
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00141
Family beta-sandwich domain of Sec23/24 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|473834344|ref|YP_007686642.1|
Sequence length 544
Comment secreted cellulase [Clavibacter michiganensis subsp. nebraskensis NCPPB 2581]
Sequence
MNIRRPLTSLMLGLLLPVAIATAGASAGAASAADQGSSASTTASGWLHTDGGKIVNSAGA
TYTIRGANWFGLESSGCVLHGLDKITLDSGMKHLHDLGFTTVRLPYANECLRTASVADWG
TSANPDLKGVSPLTMMDRAIASAKANGLNVFLDQHRPDTNGQTELWYSGSLPESQWISDW
KMLANRYKDDPTVIGVDLHNEPHGSATWGDGNTATDWRLAAERGGNAVLSVNPKLLVIVE
GTDRDSKSGTWWGGGLGDAGDKPVALSVPNRVVYSPHDYPSTIYGQSWFNAPDYPNNLPG
VWDAHWGYLAKKNTAPVLLGEFGTQLQTTSDKQWLSTLVNYLKTTGISSAYWSFNPDSNN
TGGLLKSDWVTPEQAKLDALAPILHPQNPSSSSQPQPEPQPEPQPQPQPQPEPQPEPQPQ
PQPQPQPQPQPEPQPQPQPQPEPQPSGSATATYKLDGSWPTGYTSELVITAKSAVSSWTV
SWDSPGITAVTNSWGMKCTVASSRITCTGDGWAAKIPAGQTMHVGLNVAGTQAPSNPVLT
FTSN
Download sequence
Identical sequences M5BAR3
WP_015491041.1.38469 gi|473834344|ref|YP_007686642.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]