SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|473834431|ref|YP_007686729.1| from Clavibacter michiganensis subsp. nebraskensis NCPPB 2581

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|473834431|ref|YP_007686729.1|
Domain Number 1 Region: 94-460
Classification Level Classification E-value
Superfamily (Trans)glycosidases 7.98e-37
Family Amylase, catalytic domain 0.00000161
Further Details:      
 
Domain Number 2 Region: 464-537
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.0000000000137
Family alpha-Amylases, C-terminal beta-sheet domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|473834431|ref|YP_007686729.1|
Sequence length 543
Comment glycosyl hydrolase [Clavibacter michiganensis subsp. nebraskensis NCPPB 2581]
Sequence
MGSAALTTDPAAGGHDRDGARADDRAARDDRAPADAPAAPPIDRDALAADLRPLVGDDAD
DLADALAADLRDVRARRAPAAASPADLHLDLRTGGVCYVDRYADDLRGLAARIPALRDLG
LTHLQITPVAEPADGDADDAALLAPGVRVRAGLGSAADLGALVDALHDAGLTLAVDLSAA
DADAPLADRIRGAAREAVALAAAGVDVVRVDPAAAIAERPALLRAIAALGRRVSPALALA
VAADADPRGSAELLDGDAVRLADDPALSALVWEALATRSAALLSRALERRGDAPAGSMRT
ARVRSHDALRFPFEDDDARALGIDPDEHRRFLAEYHAGGFPGSHARGIRHRDGAVAGTTA
SLAGLEQDDPGAVERILLAHSIALSTGGLPLIVLGDEVGQLNDYGYDDVPAHADDSRWVN
RPLYPFDRYDQRDDRTTSTGVVHAGIRRLIAVRRATPALGGTRVVGFDANDPHVLGYQRP
HADGTVLVLANLGDEPATVSAETLGGVAEHAVDLVRDERLRLTKGIVLSPRTFVWLQAAH
DLA
Download sequence
Identical sequences M5BB00
gi|473834431|ref|YP_007686729.1| WP_015491121.1.38469 WP_015491121.1.57954 WP_015491121.1.98982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]