SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|473834694|ref|YP_007686992.1| from Clavibacter michiganensis subsp. nebraskensis NCPPB 2581

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|473834694|ref|YP_007686992.1|
Domain Number 1 Region: 32-513
Classification Level Classification E-value
Superfamily (Trans)glycosidases 5.77e-126
Family Amylase, catalytic domain 0.000000524
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|473834694|ref|YP_007686992.1|
Sequence length 579
Comment alpha-glucosidase, glycosyl hydrolase family 13 [Clavibacter michiganensis subsp. nebraskensis NCPPB 2581]
Sequence
MTSPAPTALSTAARDDTSAHPDSAPQHGTGSEWWRTAVIYQIYPRSFADSDGDGIGDLPG
ITERLPALRELGVDAVWLSPFFLSPQNDAGYDVADYCAVDPLFGTLDDFERMQRRAHELG
LRVIVDIVPNHTSSAHRWFQEALAAPAGSEERARYMFRDGKGADGELPPNNWESIFGGPA
WTRLTEPDGTPGQWYLHLFDSSQPDLDWTNPWVRERFREILRFWLDRGVDGFRVDVAHGM
VKAAGLPDYTPPEGQGSMGGAGGVDDEPAPPPPYFAQEGVHEIYREWREIFDSYDGDRAM
VAEAWVEPLAKLADWVRPDEMHQAFNFSYLETPWDAAALRRTIDASLATFSSVGAPSTWV
LSNHDVVRHASRLALSGENPQGVGIGPRSTVTVDEELGLRRARAASALMLALPGSAYVYQ
GEELGLPEDIRLPDEARQDPTFHRTAGERYGRDGCRVPIPWEAGTPSYGFSTGDASWLPQ
PDDWDRFARDVEQADPASTLSLYTEALLLRREHGLALGALEWIDAAGDDVIAFESAGVTV
IANLGDAAVPLPEGRVLLASRPLDGDAVPSDTTVWLIRD
Download sequence
Identical sequences M5BBH6
gi|473834694|ref|YP_007686992.1| WP_015491356.1.38469 WP_015491356.1.57954 WP_015491356.1.98982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]