SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|554634977|ref|YP_008710621.1| from Gloeobacter kilaueensis Gloeobacter sp. JS

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|554634977|ref|YP_008710621.1|
Domain Number 1 Region: 3-118
Classification Level Classification E-value
Superfamily RbcX-like 8.89e-38
Family RbcX-like 0.0000321
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|554634977|ref|YP_008710621.1|
Sequence length 122
Comment hypothetical protein GKIL_0668 [Gloeobacter kilaueensis JS1]
Sequence
MDIKAITNATAQVLMSYLTYQAIRVVAAQLRETDPPRAVWFSQFSTQATLQDGEAYLEQL
TTQNPDLAFRVMTVREHLAEQVVDSLPELTRDGIRRANQQRRGRYIEQMLQLPSPESRGE
NP
Download sequence
Identical sequences U5QH29
WP_023171955.1.8008 gi|554634977|ref|YP_008710621.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]