SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|554635109|ref|YP_008710753.1| from Gloeobacter kilaueensis Gloeobacter sp. JS

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|554635109|ref|YP_008710753.1|
Domain Number - Region: 601-698
Classification Level Classification E-value
Superfamily Colicin 0.0222
Family Colicin 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|554635109|ref|YP_008710753.1|
Sequence length 710
Comment Mu-like prophage protein [Gloeobacter kilaueensis JS1]
Sequence
MDEEQEFAGSGDDQYPDAPGEENNLLEQNPELDQENQEYVAGIDPGDEAYVTDADQENQG
YTTDFDPEGQFYPDETDTSNAELYGSEYEADFTSTDTGQDEGPESSAYQGDYSPNLVGDD
YDYENFSGNFDNQDVYDSYNSLYAGQNEHFASNQADEQEDDPNVAGFVRNWGATSDTVGF
RDVNYAGEMYSSNAYSGGETSNWEQSLGQYEPGTAADADSFAGDNDESQPSLNLDNNWDW
EQTDLSGEQTTAYSFDNSSDGDEKDAQPDAAETFSQTDGPVNFEDDAQVWEPSPQEDADE
NSPDAVNRVANGVLLGEGTLDDSSDQVADSDSRSFADLAAMSWGDGPPLNFGADSDVFGL
SSGYSFLEYPEQAQPLTFSALTEAELSAGGVLVSEGVLAGSADADNGEDDKAGGFPSLTL
QNDGSGAPVVLQANATVDIGADTSTNPASEKDVNAAQVDTEAAEAGLVGLGLFQELTYPI
WKQLPNPQGKLTDFNLSFQDISGFSKPTGYAYINRVNSLTGNPTKWKGLRLDYGPNVKIP
KVDPATGEQIIDPVTNKAIPEVNWHWNQDGVNKAFGIENHTKLDSGTFGEAFGQSLKITR
PLGKVALVAGVAADAWSLGSEVNQSLQTGQWNNTVVESARIAGGWGGGWAGAEAGGGVGA
TIGTVLLPGLGTVVGGAVGGLVGGALGYFAGSEVAETAAEQATGYQRPKQ
Download sequence
Identical sequences U5QDQ9
gi|554635109|ref|YP_008710753.1| WP_023172096.1.8008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]