SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AMSG_03181T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_03181T0
Domain Number 1 Region: 2-103
Classification Level Classification E-value
Superfamily PIN domain-like 4.91e-28
Family 5' to 3' exonuclease catalytic domain 0.00061
Further Details:      
 
Domain Number 2 Region: 167-208
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 0.0000889
Family MesJ substrate recognition domain-like 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) AMSG_03181T0
Sequence length 321
Comment | AMSG_03181 | Thecamonas trahens ATCC 50062 hypothetical protein (322 aa)
Sequence
MGVKNLWRVVEPTGRRVPLEALSNQRLAIDTSIWLAQFMSAMRDADGEPLPNAHLLGMFR
RICKLLFVRIKPVFVFDGATPALKRRTVAERARRRRAAESAVSVPAAQAARKLLKQQIAS
AAAKSAGAKAAGFTSRSGGTAGVAAPRSTQAASVDTESDEEDEEEDEEELQRALEALDVP
MDLSALDMEVFKSLPPQLQRRVLRAMKRKRWINRAHRYERLQELAPTSDAFSLYQIDSLV
NKHDITAKMQEANKALEKQVDVVLDHVDDDDLAPPAQTEQAGMASIDVGSHGVISVPAHK
IMSDASQYYILAELPSSSTRG
Download sequence
Identical sequences A0A0L0D329
XP_013760032.1.50528 AMSG_03181T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]