SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AMSG_11333T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_11333T0
Domain Number 1 Region: 8-56
Classification Level Classification E-value
Superfamily KorB DNA-binding domain-like 0.0000863
Family KorB DNA-binding domain-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AMSG_11333T0
Sequence length 449
Comment | AMSG_11333 | Thecamonas trahens ATCC 50062 ParB family chromosome partitioning protein (450 aa)
Sequence
MESDYAVMVKRRLALGNLMPRIRTAYRKGEIDAETVRHLTLASKAQQKDWLALFADPEQY
APRGFQLKQWLFGGQSIPTSAALFPVEDYPGQIVADLFGEDAYFADADLFWQKQNEAIAA
KRDALLEAGWAEVVVLEPGQYFHSWEHEKTPKTKGGKVFIAVSHRGEVEVHEGWLSRKEV
RRAAKKAASADADGDATEAATVARPEATKAMQNYLDLHRHAVVRLALVAHPGVALRLMVA
HAVASSGHWQVEPEPQQAGSDAIAESVANSPAQQAFDAERQAVLALLDRPDYHHSVTQPG
YDAYPTAVVFAKLLALSDDDVLRIAACVMAETMAAGSAVVEAVGNHLGVDAGQHWQPDDA
FFDMIRDKAVLNAMLAEVAGKRCADANVAEKAKTQKKIIRDCLDGANGRAKVEGWLPGWL
AFPVRAYTENGSLKTADEWARVRNLFDAA
Download sequence
Identical sequences A0A0L0DWH9
AMSG_11333T0 XP_013752747.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]