SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AMSG_05892T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_05892T0
Domain Number 1 Region: 1025-1286
Classification Level Classification E-value
Superfamily Tropomyosin 0.000000183
Family Tropomyosin 0.00095
Further Details:      
 
Domain Number 2 Region: 817-1037
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000549
Family Tropomyosin 0.00086
Further Details:      
 
Weak hits

Sequence:  AMSG_05892T0
Domain Number - Region: 1293-1500
Classification Level Classification E-value
Superfamily Tropomyosin 0.00051
Family Tropomyosin 0.0049
Further Details:      
 
Domain Number - Region: 606-818
Classification Level Classification E-value
Superfamily Tropomyosin 0.00719
Family Tropomyosin 0.0026
Further Details:      
 
Domain Number - Region: 352-608
Classification Level Classification E-value
Superfamily Tropomyosin 0.0981
Family Tropomyosin 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) AMSG_05892T0
Sequence length 1656
Comment | AMSG_05892 | Thecamonas trahens ATCC 50062 hypothetical protein (1657 aa)
Sequence
MSVLSVEEFGLLQTELINAKQAAHEAEEGRSHAEAQLAALRKEVKTMTKDLGKAQKVIAK
SKDKKKVKALVEEVEEMKAEMRQAEAEYETRHQAMAESMRSKQLASAGVEAVDGQSHADH
NAELERLRSALAAADEAAAAAARRVEELNEGNVATQEILAAKMEQLMEYEQRVQDLETQL
AASPAPAAAPAAKADDDDDGELMLVGLDGNARADDESMARLQVEVKQAKAESTDLAASLE
KAQAEMGQLLAEMEQVKAENADLMASLEKAQAEVEQANSDVGDGVAKLQAELDAARVEVE
GVSANLQAELEQAKAENADLKAENADLMASLEKAQAEVEQAKCDAGDGVAKLQAELDAAR
VEVENASASLVNMQAEMEQAKAENADLMASLEKAQAEVEQAKCDAGDRVTRLQAELEAAR
IEVEDVTANLQAELEQAKAENTDLMASLEKSNVTVEETKAKANEMENAVADATASTAALE
TSKVELEGQFAALRTECEATAAALRDAEEARDVLAERVGELEKQRDASDTDKSHALSAVE
AQREEFRAALSAVTKDRDRLQASIAELDTKVTASEAAVVDMTKQVELLTGEMEAAKSSAA
NTEAELKAQLETEKEATAVAVNKAENMQSQLETAQTAAADTEAEIEALKTQLETEKEATA
VAVNKAENMQSQLETAQTAAADTEAEIEALKTQLETEKEATAVAVNKAENMQSQLETAQT
AAAGTEAEIEALRHSSRLRQAQRSHALSAVEAQREEFRAALSAVTKDRDRLQASIAELDT
KVTASEAAVVDMTKQVELLTGEMEAAKSSAANTEAELKAQLETEKEATAVAVNKAENMQS
QLETAQTAAADTEAEIEALKTQLETEKEATAVAVNKAENMQSQLETAQTAAADTEAEIEA
LKTQLETEKEATAVAVNKAENMQSQLETAQTAAAGTEAEIEALKTQLETEKEATATAAAK
IEALQSQLETAQSAAADTEAEIEALKTQLETEKEATATTTAKIESLQSQLETAQSAAADT
EAEIEALKTQLETEKEATAVAVNKAENMQSQLETAQTAAADTEAEIEALKTQLETEKEAT
AVAVNKAENMQSQLETAQTAAADTEAEIEALKTQLETEKEATATTTAKIESLQSQLETAQ
TAAADTSGEAQDLRSQLEAAKSTAASTVAELQSKLEEAEVKIAGTSTAFESLSHTKASLA
DELAATRKNLDALTAVNETMASKVETLTLELDSKTSALAASSASHDATATELAALRKEHA
GLESRLEEVISSRQRIEDALAATTTDAGQAQSLLKGQLDDVLAERDELRAQVVAAQAECE
RLQGELNAAVTAGDAATCSLATATSELANVSTRADRLTVELADANAQLAEATAHADSLTA
SLETVSAACDELAAAHDALQSSSTKTAELLAAAQTELDTLRSLAPALEAASARCDELEAA
NNRLAADLDSARADLHTSTSLSETMSAELEEAKAQLATASEAAELVDALKREVADTKAKA
KIDARKSQNLIKDLQSQLKSANPAAASAASAVGISVEALQEENTKLLDRIAALQTAGWKL
EEQLDDAKRALAAARQAQPAPAAASSGSKMKSLLNRVKAVASTPSPDVEALNSALSQAHE
RNAILEEQIAAMAHKLERVRKREERRKKLHQAYAEP
Download sequence
Identical sequences A0A0L0DD43
XP_013757278.1.50528 AMSG_05892T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]