SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for AMSG_09803T0 from Thecamonas trahens ATCC 50062

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  AMSG_09803T0
Domain Number 1 Region: 216-503
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase FAD-binding domain 2.22e-82
Family Cryptochrome/photolyase FAD-binding domain 0.0000133
Further Details:      
 
Domain Number 2 Region: 11-195
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase, N-terminal domain 9.81e-39
Family Cryptochrome/photolyase, N-terminal domain 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) AMSG_09803T0
Sequence length 547
Comment | AMSG_09803 | Thecamonas trahens ATCC 50062 cryptochrome photoreceptor (548 aa)
Sequence
MAARMGSRQVAMVWFRKALRVDDNPALAAAADAAAAVVPVFVLDPHLLTRAYVGDTRLVF
LLESLLALDSSLRALGSQLLVIKGTPEKGALDTLQALWREVGADSLHFEADYEPYAKIRD
AKATRMAADDKLAVETSEPNLIYPMEVWESVPDAALPTTFGGMRKLIAKRGWQPQAPIEA
PTELPPLPQAAVDAVAKDTERFAVPGMAAFPGRSEGDGSSRAFPGGEAEAQERMRAFLAD
VDRVVTFEKPKTNPFAEPPSTTGLSAHLKFGTLSVRRFYEQLRAVEEKSKRSVSQPPVSL
VGQVLWREFYTVVGSRTPGYEAMATNPLSRIIPWDDEPDKVAAWAEGRTGFPLIDAVMRQ
LRATGWVHHLARHLVACFLTRGYLWQSWEAGAGVFNSLLLDADHYLNIGNWLWLSASAFF
HQYWRVYSPISFGNKYGASAHAYVRRWVPELARLPDKHLMAPFDAPEDVLADAGVVLGRD
YPEPIVDHAAAKTANLTKMKAAYAAKRRGDPSAAAGGNDAGSSAAAVGSKRRVSGAEGEP
AGKRAKA
Download sequence
Identical sequences A0A0L0DNG2
AMSG_09803T0 XP_013754232.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]