SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tetur03g09900 from Tetranychus urticae

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tetur03g09900
Domain Number 1 Region: 171-221
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000017
Family ATI-like 0.01
Further Details:      
 
Domain Number 2 Region: 90-140
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000000549
Family ATI-like 0.007
Further Details:      
 
Domain Number 3 Region: 28-80
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000000602
Family ATI-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) tetur03g09900
Sequence length 277
Comment length:278 (n/a) (PREDICTED: similar to ECM 18)
Sequence
MFYQKIKIVISNASKVFTDCVYDAPGKCVEKCTKPKVFSTCGSACPPTCDNPNPICTLQC
VKGCFCPKGTLLNRSGECVKNCPGSGSTPSCPSPKIYNKGGSARTPTCANPKPEVCTAVC
VEGCFCPEGTLLNGSGECVKNCSSSGSNSSGSASSASSSASSSSSSTSNPSCPNPKIYNK
CGSACAPTCAAPKPEACAQVCVEGCFCPEGTLLNSSGECVKNCSSNGDNSSDSSSSASSS
ASSSSSGGSASNDDSIQKKQCVEGTFCPKGTFKYASG
Download sequence
Identical sequences T1K121
tetur03g09900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]