SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for tetur28g02430 from Tetranychus urticae

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tetur28g02430
Domain Number 1 Region: 94-154
Classification Level Classification E-value
Superfamily Cyanase C-terminal domain 5.49e-21
Family Cyanase C-terminal domain 0.00034
Further Details:      
 
Domain Number 2 Region: 16-89
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.00000000000000711
Family SinR domain-like 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) tetur28g02430
Sequence length 159
Comment length:160 (CynS) (cyanate lyase, cyanase) (n/a) (cyanate hydratase)
Sequence
MRIYSRLFQISSANYARQIMSNQFIKAKESKGLTYQQMAQLLSVNKVWLTSVLHGQNCCD
IQLAHRICDTLGISHEYANELTSIPLRGNQNIINDPLIYRFNELFKVYGSSLRGIIHEEF
GDGIMSAIDCKIDVTKNEQSRVILRIDGKFLPYYKGQLD
Download sequence
Identical sequences T1KZQ3
tetur28g02430 XP_015792109.1.93521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]