SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tetur32g00620 from Tetranychus urticae

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tetur32g00620
Domain Number 1 Region: 39-89
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000419
Family ATI-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) tetur32g00620
Sequence length 123
Comment length:124 (n/a) (hypothetical protein Y69H2.3)
Sequence
MIVKPFLPFLILILVLKCSQVNGHKRWSESKLERCSSERQEFNECGTACPPTCYLPNPEF
CTRECVARCFCKEGYFEALDGQCYTEQECVAIINAPPNTESHESMNYHLTTIQSYYKYEF
FEK
Download sequence
Identical sequences T1L1S0
XP_015792875.1.93521 tetur32g00620

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]