SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tetur95g00080 from Tetranychus urticae

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tetur95g00080
Domain Number 1 Region: 35-85
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000719
Family ATI-like 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) tetur95g00080
Sequence length 160
Comment length:161 (n/a) (scavenger receptor cysteine-rich protein)
Sequence
MYIIDINSLHWLEQYKNFSPHNDITPRTATKVWNPCGTNCPLTGANPKPRACIKSCKADY
FCPSGYLENSIGQCVIEEDCDLQRIPIDNTPTVLNYTDIPNNFSQFPESNDFQSFEPAVV
RTSGSNFPYISMSAMVPKSKPLIDLDPTVPRPVLRISKEQ
Download sequence
Identical sequences T1L6M3
tetur95g00080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]