SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tetur03g09310 from Tetranychus urticae

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tetur03g09310
Domain Number 1 Region: 40-130
Classification Level Classification E-value
Superfamily Lipovitellin-phosvitin complex; beta-sheet shell regions 0.000000000589
Family Lipovitellin-phosvitin complex; beta-sheet shell regions 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) tetur03g09310
Sequence length 136
Comment length:137 (n/a) (vitellogenin)
Sequence
MDLRLIIVLCALAATRAVPQSEIVSGQCASQCKSSELNEYPTGQTHVYKYSTRTLVNSWN
AAIDLKGEALLTRLSTCDYSVELRNVAINGIPDARAREEQLAAHPLRFAWTDGEVTDTCQ
HPEDHEWAINRLCQED
Download sequence
Identical sequences tetur03g09310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]