SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tetur05g06720 from Tetranychus urticae

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tetur05g06720
Domain Number 1 Region: 8-253
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.6e-76
Family Calponin-homology domain, CH-domain 0.0000509
Further Details:      
 
Domain Number 2 Region: 1051-1167
Classification Level Classification E-value
Superfamily E set domains 3.12e-35
Family Filamin repeat (rod domain) 0.0000323
Further Details:      
 
Domain Number 3 Region: 735-852
Classification Level Classification E-value
Superfamily E set domains 3.12e-31
Family Filamin repeat (rod domain) 0.00067
Further Details:      
 
Domain Number 4 Region: 1243-1356
Classification Level Classification E-value
Superfamily E set domains 1.13e-30
Family Filamin repeat (rod domain) 0.00037
Further Details:      
 
Domain Number 5 Region: 446-563
Classification Level Classification E-value
Superfamily E set domains 1.13e-28
Family Filamin repeat (rod domain) 0.00073
Further Details:      
 
Domain Number 6 Region: 368-465
Classification Level Classification E-value
Superfamily E set domains 1.53e-27
Family Filamin repeat (rod domain) 0.00065
Further Details:      
 
Domain Number 7 Region: 1964-2057
Classification Level Classification E-value
Superfamily E set domains 2e-27
Family Filamin repeat (rod domain) 0.0000392
Further Details:      
 
Domain Number 8 Region: 1770-1863
Classification Level Classification E-value
Superfamily E set domains 4.74e-27
Family Filamin repeat (rod domain) 0.0000721
Further Details:      
 
Domain Number 9 Region: 1592-1682
Classification Level Classification E-value
Superfamily E set domains 1.47e-26
Family Filamin repeat (rod domain) 0.0000701
Further Details:      
 
Domain Number 10 Region: 2154-2244
Classification Level Classification E-value
Superfamily E set domains 4.4e-25
Family Filamin repeat (rod domain) 0.0000775
Further Details:      
 
Domain Number 11 Region: 269-365
Classification Level Classification E-value
Superfamily E set domains 5.94e-25
Family Filamin repeat (rod domain) 0.00058
Further Details:      
 
Domain Number 12 Region: 1154-1262
Classification Level Classification E-value
Superfamily E set domains 6.67e-25
Family Filamin repeat (rod domain) 0.00028
Further Details:      
 
Domain Number 13 Region: 563-655
Classification Level Classification E-value
Superfamily E set domains 5.14e-24
Family Filamin repeat (rod domain) 0.0000973
Further Details:      
 
Domain Number 14 Region: 660-756
Classification Level Classification E-value
Superfamily E set domains 3.57e-22
Family Filamin repeat (rod domain) 0.001
Further Details:      
 
Domain Number 15 Region: 2279-2370
Classification Level Classification E-value
Superfamily E set domains 1.4e-21
Family Filamin repeat (rod domain) 0.0000597
Further Details:      
 
Domain Number 16 Region: 1670-1767
Classification Level Classification E-value
Superfamily E set domains 8.01e-21
Family Filamin repeat (rod domain) 0.0000887
Further Details:      
 
Domain Number 17 Region: 980-1073
Classification Level Classification E-value
Superfamily E set domains 1.68e-20
Family Filamin repeat (rod domain) 0.00059
Further Details:      
 
Domain Number 18 Region: 1885-1978
Classification Level Classification E-value
Superfamily E set domains 9.34e-20
Family Filamin repeat (rod domain) 0.00016
Further Details:      
 
Domain Number 19 Region: 1340-1401,1437-1486
Classification Level Classification E-value
Superfamily E set domains 1.53e-17
Family Filamin repeat (rod domain) 0.0012
Further Details:      
 
Domain Number 20 Region: 2071-2168
Classification Level Classification E-value
Superfamily E set domains 9.34e-16
Family Filamin repeat (rod domain) 0.00018
Further Details:      
 
Domain Number 21 Region: 1532-1588
Classification Level Classification E-value
Superfamily E set domains 0.000000000000187
Family Filamin repeat (rod domain) 0.0011
Further Details:      
 
Domain Number 22 Region: 831-934
Classification Level Classification E-value
Superfamily E set domains 0.0000000000327
Family Filamin repeat (rod domain) 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) tetur05g06720
Sequence length 2371
Comment length:2372 (CHER) (Filamin A, Cheerio orthologue) (n/a) (PREDICTED: similar to Filamin C)
Sequence
MGVTDDRRGNPDEEDIMERELAEDAVWKRIQKNTFTRWANEHLKTVNSHIENLETDFEDG
TRLVALVEVLSGKRLPRHNKKPKLRAQKLENVNIALNFLTQQEGIKIVNIDSTDVVDGHL
KLILGLIWTLILHYSISMPMWEGEDDSMYRGRGEPTPKQRLLGWIKNKIPEVPVNNFTTD
WNSGKALGALVDAVAPGLCPDWPDWKPEDALKNTKEAMKLADDWLNVPQLIKPDDVVDPK
VDDLSMMTYLSQYPNAKLKEGAPLRPRNNPNRVRCYGPGIQPDGVVKGAQTNFTVETFSA
GKGKVEVFIADPTGKMEPVAAKFNDDPSKTYTCSYTPKVEGQHKVIVKFNGVEVPKSPFS
VNVEGVAGDASKVTASGPGLQPTGVQVGKPTYFDVFTKGAGKGQLEVVILDPSGKPNTVP
LRVRPIGDDVYRCEYVAQATGVHSVNVFFAGKQVPKSPFGVRVSPICDPRKVRASGRGLQ
PTGVRVGDVADFKVTTDGAGEGNLDIKVIGPDGKPEKVNIRKVDGTTFDCDYKPTKTGKY
VVIVSFGNQEIFRSPFEVNVGPPKQSKIRAFGPGLKGGVVGYPAKFTVDTNGETGTLGFT
IEGPSEAKIQCMDNGDGSAEVIYYPTAPGEYAIHVLNNGEDIPQSPWVAQITSKPGPDFA
PDKVVTAGKGIGPTVVQGKPTDFTVDTRKAGKAPLDVSVIDKACEPLPMKIANAKDGTVK
CEYKPENPDKHVVQVNYGGVAVPGSPFKVQVAPPTDAAKVKIFGPGVEPGVKPGVPTFFN
IDAEAAGPGQLKVSLKDDKGKDVPIQLQDNENNTYSVDYTVPKAGIYTVNATYSGQPIPG
CPITVPVTPAADLSKVKVEGLEPIAVMNNLYQFRVIIDDSLSEIPFIHDYITICITSPSG
QSIRPHIINTSEGCLVNFVPIEMGQYLLSVYLAGSGYDDVKPKHIYCLPEHKLSVVNRSS
PIPGHNQVKVHSQAPIDLPIYGRAFADAVFVDSPTEFTVDTRALPKKSEATVTCKITNPS
GAQTATAVTKAKDGTHKVAFTPFEEGPHKVDVMVDGQPVKGSPFAVNATRGCNPGKVKAY
GPGLEQGIVNQKNTFTVETKGAGIGALGLSIEGPSEAKMNCRDNRDGTCTVDYVPIETGD
YDIGIKFANKQIPGSPFRVPVDHPVDVSKVTAFGPGLDPANCRAGPPLPFTVDASKTGKA
PLTVEVSSEKGPVPYSPEINDSGDGIYDVSYLPPPEGSKCNVNVKYGGQPIPGSPFQMKV
KPMTEPQNVKLSGPGIAKTIPASFPAEFTIDAKNAGYGRPEVKIQAPDGSKCKASIIDNQ
DGTYKVNYTPDDVGNYKIGVTFGGKPVPGAPITVKTTATGQADKCKIAQKIKETVAAGEE
QCLQVDARQAGKGAVTCKVNKVKEETRTEKQSTTTTKSQVKKVIKQTTTEEEEIEEEEEI
IEYRVIDNKDGTYNVYYKAIEQGDYKVDLKFGGQPIPNGSFSIKTTSTTEEIKTRRTVIK
KSESSYSEVREFRQIQLYNVPVPPSSVEPKRRAFIKMPSGATDKPTIIDNHDGTISVKYD
PKEEGLHELHIIYNEDPIAGSPFKFFVDRLSSGAVTAAGPGLTHGIAGEPSDFTIYTKGA
GNGGLQVAVEGPSKADIQYVDNSDSTVSVSYLPILPGEYKIVVKFAGRHIKGSPFTAKIT
GEGRKRAQLSVGHSSEVSLKCSEKDIRNLAATIVAPSGLEEPCFVKKLPNGHLGISFTPR
ECGEHCIHVKRMGKHISGSPFKINVLEREIGDASKVMVSGNALKEGHTHVDNEFVIDTKE
AGFGGLSLSIEGPSKAEINCKDNEDGTLNVAYKPTEPGYYIINLKFADHHVPGSPFTVKV
TGQGSNIQRENIKKQRDALPITDVGSECKLTFKMPGTAAMDMNATVTSPSGKTEDAEILD
LDDCLYAVNFIPKEVGVHTVSVKYKDAHIPGSPFQFTVGPLREYGAHRVHAGGPGLERGV
VNELCEFNVWTREAGAGSLSLSVEGPSKADIDFKDRKDGSCLVAYKVTEPGEYRVGIKFN
DQHIPDSPFKVWVMPQINEAKRVELRALPNENSLKVGSPVTIIINLNGARGVLDAKIISP
TGLEDDCFITMIDADEHALRFIPKENGVHTLHIRFNGVHIKESPYRLRVGKDTADPAAVT
AFGPGLKDIKSGVKTEFIVDTCSAGHGRLSVSVDGPSKVSMDCTECEEGYKVRYTPLCPG
EYYITVKYNGYHIVGSPFRVRCTGDKVIPISEAESASLAVETQDKALGRVGGLPRFKSDA
AKVTVRGNGTKKALVGRPTSLTVDGQRAGSNILFAAVYGPKGPCDDVTIKHLGLNVYNVT
YNLKDKGDYVLIVKWGDDHIPGSPFKVEATP
Download sequence
Identical sequences T1K5L8
tetur05g06720

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]