SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tetur05g09170 from Tetranychus urticae

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tetur05g09170
Domain Number 1 Region: 17-245
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.11e-87
Family Calponin-homology domain, CH-domain 0.0000205
Further Details:      
 
Domain Number 2 Region: 414-534
Classification Level Classification E-value
Superfamily Spectrin repeat 2.09e-25
Family Spectrin repeat 0.0000112
Further Details:      
 
Domain Number 3 Region: 643-775
Classification Level Classification E-value
Superfamily EF-hand 1.83e-22
Family EF-hand modules in multidomain proteins 0.066
Further Details:      
 
Domain Number 4 Region: 538-650
Classification Level Classification E-value
Superfamily Spectrin repeat 3.45e-18
Family Spectrin repeat 0.0000194
Further Details:      
 
Domain Number 5 Region: 272-353
Classification Level Classification E-value
Superfamily Spectrin repeat 4.32e-17
Family Spectrin repeat 0.0000265
Further Details:      
 
Weak hits

Sequence:  tetur05g09170
Domain Number - Region: 367-410
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000128
Family Spectrin repeat 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) tetur05g09170
Sequence length 803
Comment length:804 (n/a) (alpha-actinin-4)
Sequence
MSEYDVDGYIEQEDDTRDGLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRNGLK
LMLLLEVISGESLPKPDRGKMRFHKIANVNKALDFIASKGVRLVSIGAEEIVDGNVKMTL
GLIWTIILRFAIQDISVEEMTAKEGLLLWCQRKTAPYKNVNVQNFHMSWKDGLAFCALIH
RHRPDLLDYSSLSKDHPLENLNLAFDIAEKHLNIPKMLDAEDINSAAWPDERAIMTYVSS
YYHTFSRAQLRLQLTGYAKFSKLTRKMNASWKIQKKLEEFRQYRRAHKPPRVEQKARLET
NFNTLQTKLRLSNRPAYLPTEGKTVADIANAWKGLEAAERGFEEWLLSEMMRLERLDHLA
QKFKHKADIHEEWTRGYHGSVQVNERCQRICNQWDQLGTLTQTRRIALEEAESVLEKIDT
LHLEFAKRAAPFNNWLDGAREDLVDMFIVHTIEEIQGLIEAHEQFKMTLGEADKEHKSII
ALSQEVSSIATKYQVPGGIENPYTSLTPDEISNKWADVKQLVPKRDQVLSTESMRQQRNE
ALRRKFGERANVVGPWIERQMDAVAAVGMGIQGTLEDQKNKLLQYEQAVNQYRPNMDELE
KIHQEVQESMIFENRYTQFTMETLRVGWEQLLTSIRRNINEVENQILTRDSKGITQEQLN
EFRMSFNHFDKTRSGRLNPDEFKSCLVSLGYNIRSDRQGDADFRRIMLIVDPNNTGYVTF
DTFLDFMTREATDTDTAEQIIDSFRILAGDKSYITADELRRELPPDQAEYCIKRMAPYRG
TGAVPGALDYMSFSTALYGESDL
Download sequence
Identical sequences tetur05g09170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]