SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tetur11g04270 from Tetranychus urticae

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tetur11g04270
Domain Number 1 Region: 17-198
Classification Level Classification E-value
Superfamily p53-like transcription factors 2.73e-70
Family Rel/Dorsal transcription factors, DNA-binding domain 0.000000256
Further Details:      
 
Domain Number 2 Region: 193-313
Classification Level Classification E-value
Superfamily E set domains 7.47e-41
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.0000461
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) tetur11g04270
Sequence length 624
Comment length:625 (dl) (dorsal)
Sequence
MNLSMMMPDNYAEDYGGPRVKILEQPARCALRFRYECEGRSAGSIPGANSTPENKTYPTI
QIESFKGPAVVVVSCVTKDFPYRPHPHNLVGKDGCKKGVCTMVINNSDMICSFTSLGIQC
VKRKDIEESLKLRESIKVDPFRTGFAHKNQASSIDLNVVRLCFQVFVEGSEKDKFTVPLK
PIVSDPIYDKKAMSDLIITKLSHFSASVTGGKEIILLCDRVAKDDIQVRFYEESKGQIIW
EGYADFQPNDVHKQVAISFRSPKYYNENISQPVTVNIQLRRPSDGHTSEPRQFQFLPKGI
DPDGLTRKRQKVEESGCIDRYLKDNSSIMSQIQSQSTQSRRLSPIGYPSSSRSPLRPQEP
VSPAIPDRIEVDAQSEQSQWNDFSQAPGSSLGTSLGTQRRSPTYNLNMVNSPSPTSLSHC
IQEPLVQSTPSAIPQTISYSLSPHYSSSPRSSIDMGAMKPSTSNQHLLQPKQSQSFQICS
DNLNPSNLNQQLTENNFISPSSNNFLPNLSPVAMSNNFVEPVSSLNSSYQAQPSSGFTQS
HQHPIPSMIPSVDNLNNNEVEGTLSSKLDSLDLDIDSHELIRDIGLNNWLVMMDSGNNVN
ISNSGTINLNNDPNTLHDNRTSHL
Download sequence
Identical sequences T1KHG0
XP_015786990.1.93521 tetur11g04270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]