SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tetur22g00250 from Tetranychus urticae

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tetur22g00250
Domain Number 1 Region: 34-88
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000000589
Family ATI-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) tetur22g00250
Sequence length 90
Comment length:91 (n/a) (RecName: Full)
Sequence
MKSIVLIFTVTLVIVCISSIKSDPAKWTDDIDDPCPTDRVYNPCGSACPLTCAQPKKGKC
NRMCVPGCFCKPGLYENAAGNCVTLDECYN
Download sequence
Identical sequences T1KUK2
tetur22g00250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]