SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tetur22g00260 from Tetranychus urticae

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tetur22g00260
Domain Number 1 Region: 32-77
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000018
Family ATI-like 0.009
Further Details:      
 
Domain Number 2 Region: 91-140
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000589
Family ATI-like 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) tetur22g00260
Sequence length 140
Comment length:141 (n/a) (PREDICTED: similar to ECM 18)
Sequence
MKTKFILTFIVFLVFITVSYELYVPRKVQKRIIGCGTACPRTCSNPKIDSCIQVCTGNPE
CPEGYFENNIGKCVLWKDFSLCEDKPRKVEKVMIGCGSACPLTCKYPEPRMCIQVCTGLP
ECPRGYYENHLGECVLREDC
Download sequence
Identical sequences T1KUK3
tetur22g00260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]