SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tetur22g00290 from Tetranychus urticae

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tetur22g00290
Domain Number 1 Region: 41-91
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000314
Family ATI-like 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) tetur22g00290
Sequence length 251
Comment length:252 (n/a) (cysteine-rich trypsin inhibitor) (n/a) (PREDICTED: hypothetical protein)
Sequence
MSFLLYTVALNLLVLAVSANHSAPIETGQLTSVFKPPTAAKVYNSCGSACPPTCANPEPK
FCILVCKADWFCPKDYYLNSAGNCVLKEYCDNVQPTPDPVPLPQPFPTYPFPRPFPRPFP
RPLPRPFPRPFPVPFPEPFVQNVTEVSDDFGRFPEWPSFQSFEPVESPQIRLSSYPTLPS
FQISPINYNATAVANGAPIPPPAVVRTSGSNAPYIPSPPMVPQIKPLIDLDPTVTRPVLR
VSKEQSSEDEK
Download sequence
Identical sequences T1KUK5
tetur22g00290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]