SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tetur40g00200 from Tetranychus urticae

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tetur40g00200
Domain Number 1 Region: 202-252
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000000929
Family ATI-like 0.0079
Further Details:      
 
Domain Number 2 Region: 92-143
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000183
Family ATI-like 0.011
Further Details:      
 
Domain Number 3 Region: 45-92
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000458
Family ATI-like 0.0087
Further Details:      
 
Domain Number 4 Region: 157-201
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000119
Family ATI-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) tetur40g00200
Sequence length 335
Comment length:336 (n/a) (PREDICTED: similar to ECM 18)
Sequence
MKSMIIILVTLFSFASCSFPEFFSFFGKPHSSDSGSASTGFTNTSKVFTDCGSLCPPTCA
KPKPGICATVCVEGCFCPKGTIENAAGKCVKQCSKSKVFNSCGSPCPPTCANPNPGFCGT
ACVRGCFCPKGTLENAYGECVEQCSSNGPASYDYIPKVYSTCGSACPPTCANPNPICSQQ
CVEGCFCPKGTIEDASGKCVKQCSKSKVYNECGSLCPPTCANPKPGPCAAVCVKGCFCPK
GTFENAAGECVEQCLTNGSSSSGSGSSASSGASSSSSGGSAASSSGSSASSGGSSSSASG
AAASSGGSSDSSAVASATSGASDSSGESAFNGDSI
Download sequence
Identical sequences T1L4R5
tetur40g00200 XP_015793763.1.93521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]