SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tetur95g00060 from Tetranychus urticae

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tetur95g00060
Domain Number 1 Region: 44-94
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000183
Family ATI-like 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) tetur95g00060
Sequence length 120
Comment length:120 (n/a) (PREDICTED: similar to ECM 18)
Sequence
MIFLIFTLAVNFLVLAVSANKTVPITDSTSAQSTIDSRPRTAAKVWNPCGTNCPLTCANP
KPRACIKSCKADFFCPSGYLENSIGQCVFEEDCDNLQPIPIDNPVPLPRPFPRFPGFRPX
Download sequence
Identical sequences T1L6M1
tetur95g00060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]