SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for tetur95g00090 from Tetranychus urticae

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  tetur95g00090
Domain Number 1 Region: 109-160
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000000131
Family ATI-like 0.019
Further Details:      
 
Domain Number 2 Region: 50-101
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000000314
Family ATI-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) tetur95g00090
Sequence length 247
Comment length:248 (n/a) (PREDICTED: similar to ECM 18)
Sequence
MKSMIIILAMLFSFAACTLPDLSASIIIGTTGASKFTGCVHDASGKCVEQCEKPKVFLEC
GSLCPPTCAKPKPEACAAVCVKGCFCPKGTFLTDSGKCVEKCSSDGNPWCPNSKVYTDCG
SACPPTCANPNPGPCAAVCVKGCFCPKGTLENASGECVKQCSSNGSNSSGSGSSASSGSS
SGGSAASSSGSSAASGRYSDSSSVAGATSGGSAASSGGSSDSSAVASATSGGSSDSSGES
AFNGDSI
Download sequence
Identical sequences T1L6M4
XP_015794061.1.93521 tetur95g00090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]