SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|478471410|ref|YP_007740013.1| from Chlamydia trachomatis L2b/LST

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|478471410|ref|YP_007740013.1|
Domain Number 1 Region: 334-410
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 6e-16
Family CorC/HlyC domain-like 0.0023
Further Details:      
 
Domain Number 2 Region: 188-320
Classification Level Classification E-value
Superfamily CBS-domain pair 0.00000000000299
Family CBS-domain pair 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|478471410|ref|YP_007740013.1|
Sequence length 414
Comment hypothetical protein L2BLST_00261 [Chlamydia trachomatis L2b/LST]
Sequence
MFSSAIVILTAIFVLCSGFVSLSHIALFSLPSSLIAHYSHSKNRQLRQIANLMAYPNHLL
ITLVFFDIGINIGVQNCIATLVGDSASLLLTVGVPLALTLVLGEIVPKVIAIPYNARIAK
IVTPIIFASTKSFRPIFDWAISGINFIVQKMLARQESDFIQPQELKEVLRSCKDFGVVNH
EESRLLFGYLSMEEGSIKERMTPKQEIIFYDVLTPIENLYKLFSGPKQSYSKVLVCKGGL
QNLLGVCSAKLLLLYKEKLQSAEELLPLLRKPHYIPETVSAKTALYHLAGEDCGLGIIID
EYGSIEGLITQNDLFKIVSDEVAHNRPSFKQFAHSDKNVVIAAGTYELSDFYDLFGVDLP
TTANCVTIGGWLTEQLGEIPETGTKFAWGQFVFQILDAAPNCVKRVYIRKTHGN
Download sequence
Identical sequences A0A0E9DZ80 A0A0H3MKW3
gi|166155342|ref|YP_001653597.1| gi|478447975|ref|YP_007722009.1| gi|478466910|ref|YP_007718442.1| gi|339625915|ref|YP_004717394.1| gi|166154467|ref|YP_001654585.1| gi|478451576|ref|YP_007714882.1| gi|478467811|ref|YP_007742684.1| gi|478465111|ref|YP_007741793.1| gi|478471410|ref|YP_007740013.1| gi|527323717|ref|YP_008349913.1| gi|478449775|ref|YP_007719332.1| gi|478464211|ref|YP_007740903.1| gi|527318068|ref|YP_008344270.1| gi|527325776|ref|YP_008351969.1| gi|478453389|ref|YP_007717551.1| gi|478469620|ref|YP_007722900.1| 471472.CTL0508 471473.CTLon_0504 gi|527327626|ref|YP_008353817.1| gi|478452476|ref|YP_007720224.1| gi|482546558|ref|YP_007852474.1| gi|478450676|ref|YP_007721118.1| gi|482545615|ref|YP_007851533.1| gi|478447083|ref|YP_007715771.1| gi|478470519|ref|YP_007729160.1| gi|478454281|ref|YP_007716660.1| gi|527321815|ref|YP_008348013.1| gi|527326698|ref|YP_008352890.1| gi|478462414|ref|YP_007738235.1| WP_009873677.1.100883 WP_009873677.1.101735 WP_009873677.1.11148 WP_009873677.1.11732 WP_009873677.1.17082 WP_009873677.1.18643 WP_009873677.1.22210 WP_009873677.1.25195 WP_009873677.1.27753 WP_009873677.1.27980 WP_009873677.1.32801 WP_009873677.1.38181 WP_009873677.1.38794 WP_009873677.1.40464 WP_009873677.1.40808 WP_009873677.1.42718 WP_009873677.1.45552 WP_009873677.1.48923 WP_009873677.1.49465 WP_009873677.1.51159 WP_009873677.1.53299 WP_009873677.1.5416 WP_009873677.1.58046 WP_009873677.1.58308 WP_009873677.1.5967 WP_009873677.1.60427 WP_009873677.1.62489 WP_009873677.1.64162 WP_009873677.1.71307 WP_009873677.1.79775 WP_009873677.1.83642 WP_009873677.1.85365 WP_009873677.1.97423 WP_009873677.1.99598 YP_001654585.1.27483 gi|478463313|ref|YP_007739125.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]