SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|385837457|ref|YP_005875087.1| from Lactococcus lactis subsp. cremoris A76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|385837457|ref|YP_005875087.1|
Domain Number 1 Region: 12-105
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 1.19e-32
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|385837457|ref|YP_005875087.1|
Sequence length 116
Comment PTS system cellobiose-specific transporter subunit IIA [Lactococcus lactis subsp. cremoris A76]
Sequence
MTDKYENPTSDDYMGVVMGIIMSGGNAKGLAFQAIQQAKDGKFAEAESSLNEASEQLREA
HDVQTDLLTRLAQGEKIGWNLYMVHAQDHLMNAITFKDLAVEVVGQERRLQALENK
Download sequence
Identical sequences A0A084ACB6 A0A0M2ZW20 A2RIE7 G8P5W4 Q031Q3 T0TH35 T0VDH5 T2F3Y3
gi|116511275|ref|YP_808491.1| gi|125623305|ref|YP_001031788.1| gi|385837457|ref|YP_005875087.1| 272622.LACR_0466 416870.llmg_0438 gi|389853633|ref|YP_006355877.1| gi|414073713|ref|YP_006998930.1| WP_011675489.1.100658 WP_011675489.1.101083 WP_011675489.1.11522 WP_011675489.1.11672 WP_011675489.1.1284 WP_011675489.1.14741 WP_011675489.1.22176 WP_011675489.1.31408 WP_011675489.1.33726 WP_011675489.1.37992 WP_011675489.1.38018 WP_011675489.1.38190 WP_011675489.1.40456 WP_011675489.1.48741 WP_011675489.1.48880 WP_011675489.1.57259 WP_011675489.1.63588 WP_011675489.1.6822 WP_011675489.1.77612 WP_011675489.1.81028 WP_011675489.1.86027 WP_011675489.1.8856 WP_011675489.1.8915 WP_011675489.1.90014 gi|544393802|ref|YP_008568086.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]