SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|414076612|ref|YP_006995930.1| from Anabaena sp. 90

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|414076612|ref|YP_006995930.1|
Domain Number 1 Region: 2-116
Classification Level Classification E-value
Superfamily RbcX-like 2.88e-43
Family RbcX-like 0.00000156
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|414076612|ref|YP_006995930.1|
Sequence length 126
Comment RbcX protein [Anabaena sp. 90]
Sequence
MDLKQIAKDTAKTLQSYLTYQALRTVLAQLGETNPPLAHWLQNFSAGKIQDGEAYIEELF
LEKSDLALRIMTVREHIAAEVTEFLPEMVITGIQQANMEQRRQHLERITQLSLSSPSLEI
PKTDNI
Download sequence
Identical sequences A0A1B7WGF4 D7UST9 D7USU1 K7VZC7 O88136 Q5W3Q4 Q5W3R4 Q5W3R6 Q5W3R8 Q798D5 Q7AZ04 Q7AZ09 Q7AZ13 Q7AZ14
gi|414076612|ref|YP_006995930.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]