SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|414076847|ref|YP_006996165.1| from Anabaena sp. 90

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|414076847|ref|YP_006996165.1|
Domain Number - Region: 364-389
Classification Level Classification E-value
Superfamily YggU-like 0.0562
Family YggU-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|414076847|ref|YP_006996165.1|
Sequence length 766
Comment type II and III secretion system protein [Anabaena sp. 90]
Sequence
MKQLHNSVFGSSVAAFVLLAAQPVLAKITQITDVELSPIAGGVSVILKTAAGDRPQVFTT
KKDKSLVADVINTQLRLPKGNNFLQKNPAPGIASIEVKQLDANSIRVTVTGIDDAPSNQP
VMGKDNNITLGFTATTNSTASTATKPTEKVAVTPATTKPTEKVAVTPATTFEYKPDEPGK
QPDVLVPNPQVTIDGKITQTPNPGQAYKQSPVFLPKAVAPPVGDITQSNIDTSPVVINLG
TKERVRRLVLRDAPVREVLSLLARAAGLNLAYIGGEAEKPQDAENVTKTSQKISLDIENE
PVQDVFNYVLRLSGLEANRSGRTIFVGTQLPNSSRNLVMRNLRLNQVTVDVALNFLVALG
AESAVSRERLVTSVNAVPVGGAANTAVTQAQTTTETKIETQRITYTDSTPILRGLQASGD
ERTNSVTLIGSPKMVEMAVSQLTQLDIRRRQVVVNVKIIDVNLTGTQGYNTSFSFGVGNN
FFVNDGGAASLNFGGSRPANSNEVNNTVTETPVTNNPLQAGDVVNSAAGINRDPTVAGNK
TGGIPTLYQFPRRLLTSLQAQVISGNAKILTDPTLIVQEGQNAVVNLTTEVYAGLKISSQ
STGTTSSTTSSSVSEPIIKKAGLSLNVKVERIDDNGFVSLSVAPTVSAPGGTAPAGGDNG
TITLLSERSLASGVLRLRDSQTLILSGIIQDTDRTSVSKLPILGDIPLLGALFRKTNKQN
ERREVIILLTPQIMDDSQSSGYGYNYTPSPTAREMLERRGVKLQPR
Download sequence
Identical sequences K7VZW7
gi|414076847|ref|YP_006996165.1| WP_015079514.1.50365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]