SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|414076863|ref|YP_006996181.1| from Anabaena sp. 90

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|414076863|ref|YP_006996181.1|
Domain Number 1 Region: 4-73
Classification Level Classification E-value
Superfamily YggU-like 4.19e-24
Family YggU-like 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|414076863|ref|YP_006996181.1|
Sequence length 74
Comment hypothetical protein ANA_C11595 [Anabaena sp. 90]
Sequence
MQKRVKVKPNSQQQKIEELADGSLTVHLKSPPVDGKANEELIKLLAKKFDVAKSSIRIKS
GTTSRQKVIEIDGI
Download sequence
Identical sequences A0A1B7UUR2 A0A1B7V1L5 A0A1B7WQU0 K7WFT2
WP_015079530.1.50365 gi|414076863|ref|YP_006996181.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]