SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|414077171|ref|YP_006996489.1| from Anabaena sp. 90

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|414077171|ref|YP_006996489.1|
Domain Number 1 Region: 449-541
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.00000000000000222
Family Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.01
Further Details:      
 
Domain Number 2 Region: 375-440
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 0.000000000000016
Family Mechanosensitive channel protein MscS (YggB), middle domain 0.001
Further Details:      
 
Weak hits

Sequence:  gi|414077171|ref|YP_006996489.1|
Domain Number - Region: 141-198
Classification Level Classification E-value
Superfamily Protein prenylyltransferase 0.0497
Family Protein prenylyltransferase 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|414077171|ref|YP_006996489.1|
Sequence length 585
Comment mechanosensitive ion channel protein [Anabaena sp. 90]
Sequence
MNKYTNKNKYLNILNKFMISLICCIFIINISMGYSQDKTVTIQDKAIPVAQNSEIVNKID
GTPVLLGNTTLFVIQKNVGSFSHQARAQAVTNRLEKIANDPLISMDKLRVVENSDTTNIV
IGDKTLFTITDKDAKAVNKTRQILAEKCIEIIRNAINQYRKERSLYNILKGLFYTFISTV
ILFVFLKVFNQVYPRIITKLQNWRGIRIPELRIQNIELLPTARVSNIVTRLVKIICIIIV
ISILYIYISLVLSFFPWTKQISSRLISYFLGAIYKSWLAFADYLPNIFALALIFFITHYS
LKFIRYIFTELGNGNISISGFYNDWAEPTYKLVFLIIVALALVLAFPYLPGFGSPAFQGI
SVFLGVLFSLGSTAVITNVVAGTILIYTRAFQIGDRIKIGDAIGDIVEKTLLVTRIRTIK
NVIITIPNGTVLTSQIINYSSLSQDPNYYLILNTTITLGYDVPWRKVHQVLIDAAIATNN
ILAEPVPFVFQTSLDDFYVSYELNAYTNKPILMASIYSELHQNIQDKCNEAEIEILSPHY
SAVRDGNQTTIPENYLPQDYKSPGFRLSSLNNLFNPDNSKNTPDS
Download sequence
Identical sequences K7WVS9
gi|414077171|ref|YP_006996489.1| WP_015079837.1.50365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]