SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|414077310|ref|YP_006996628.1| from Anabaena sp. 90

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|414077310|ref|YP_006996628.1|
Domain Number 1 Region: 2-114
Classification Level Classification E-value
Superfamily Ribosomal protein L20 2.22e-51
Family Ribosomal protein L20 0.0000237
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|414077310|ref|YP_006996628.1|
Sequence length 118
Comment 50S ribosomal protein L20 [Anabaena sp. 90]
Sequence
MTRVKRGNVARKRRNKILKLAKGFRGSHSTLFRTANQQVMKALRSAYRDRKKKKRDFRRL
WIARINAASRQHGLSYSRLIGNLKKANVELNRKMLAQLAILDPASFAKIAELANSVNG
Download sequence
Identical sequences A0A0B0QQM4 A0A0K2M0W5 A0A1B7UX80 A0A1B7UZ88 A0A1B7W6X0 A0A1Z4V4S9 K7VX71
gi|414077310|ref|YP_006996628.1| WP_015079973.1.48885 WP_015079973.1.50365 WP_015079973.1.77557 WP_015079973.1.86490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]