SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|414077828|ref|YP_006997146.1| from Anabaena sp. 90

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|414077828|ref|YP_006997146.1|
Domain Number - Region: 95-148
Classification Level Classification E-value
Superfamily Domain of the SRP/SRP receptor G-proteins 0.0593
Family Domain of the SRP/SRP receptor G-proteins 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|414077828|ref|YP_006997146.1|
Sequence length 151
Comment hypothetical protein ANA_C12616 [Anabaena sp. 90]
Sequence
MPPTQANCEIYEQDYPEWLDITLTQLQNRDLENIDWEHLIEEITALGNEQRRKVESYLRQ
LIKHLLLYQYWEAERFYCAKGWIEEIDNFRSELDLLLESKVLYNHCEKIIDKIYTKARNN
TIRKSELSPTIFPETCPYSLTEILNPEWLPS
Download sequence
Identical sequences K7WID6
WP_015080488.1.50365 gi|414077828|ref|YP_006997146.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]