SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|414078832|ref|YP_006998150.1| from Anabaena sp. 90

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|414078832|ref|YP_006998150.1|
Domain Number 1 Region: 26-218
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 2.2e-56
Family Class I glutamine amidotransferases (GAT) 0.00000573
Further Details:      
 
Domain Number 2 Region: 203-461
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 4.19e-54
Family N-type ATP pyrophosphatases 0.00000315
Further Details:      
 
Domain Number 3 Region: 420-540
Classification Level Classification E-value
Superfamily GMP synthetase C-terminal dimerisation domain 4.84e-54
Family GMP synthetase C-terminal dimerisation domain 0.0000123
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|414078832|ref|YP_006998150.1|
Sequence length 540
Comment GMP synthase [Anabaena sp. 90]
Sequence
MNTAVTLPTEKIPQTPENLGKLKGQIIVILDFGSQYSELIARRIRETQVYSEVISYRTTA
EQLREINPKGIILSGGPNSVYSDYAPHCDPEIWKLGIPVLGVCYGMQLMVNQLGGEVIQA
ERGEYGKASLYIDDPTDLLTNVEEGATMWMSHGDSVTNMPPGFELLAHTDNTPCAAIAHH
DKKLYGVQFHPEVVHSQGGIALIRNFVYHICDCEPTWTTAAFVEESIQEIRAKVGDKRVL
LALSGGVDSSTLAFLLYKAIGEQLTCVFIDQGFMRKLEPERLVKLFKEQFHIPVEYVNAR
ERFISAIAGVTDPEEKRRRIGHEFISVFEETSRDLGHFDYLAQGTLYPDVIESADTNVDP
KSGERVAVKIKSHHNVGGLPKDLRFKLVEPLRKLFKDEVRKVGRSIGLPEEIVQRQPFPG
PGLAIRILGEVTSERLNILRDADLIVRQEINQRGLYNEVWQAFAVLLPVRSVGVMGDKRT
YAYPIVLRIVTSEDGMTADWARIPYDILEAISTRIVNEVKGVNRVVYDITSKPPGTIEWE
Download sequence
Identical sequences K7W5Q4
gi|414078832|ref|YP_006998150.1| WP_015081469.1.50365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]