SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|414079581|ref|YP_007001005.1| from Anabaena sp. 90

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|414079581|ref|YP_007001005.1|
Domain Number 1 Region: 3-64
Classification Level Classification E-value
Superfamily Zn-binding ribosomal proteins 2.38e-18
Family Ribosomal protein L33p 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|414079581|ref|YP_007001005.1|
Sequence length 64
Comment 50S ribosomal protein L33 [Anabaena sp. 90]
Sequence
MAKSKGARIIVTLECTECRTNPDKRSPGVSRYTSTKNRRNTTNRLELKKFCTHCNKHTVH
KEIK
Download sequence
Identical sequences A0A1Z4V3C7 K7WN05 Q3MDJ2 Q8YNV9
gi|17231944|ref|NP_488492.1| gi|75907543|ref|YP_321839.1| gi|414079581|ref|YP_007001005.1| 103690.asl4452 240292.Ava_1320 WP_010998585.1.33676 WP_010998585.1.44637 WP_010998585.1.48885 WP_010998585.1.50365 WP_010998585.1.60463 WP_010998585.1.77557 WP_010998585.1.86490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]